PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 328aa    MW: 36474.5 Da    PI: 6.4175
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002593genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+l d+++ +G g+W+t ++  g+ R++k+c++rw +yl
      Lus10002593 14 KGPWTSEEDEKLMDYIRDHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.32.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia ++  gRt++++k++w+++
      Lus10002593  67 RGRFSSEEEEVIIQLHSVLGNK-WSAIATRLS-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.713961IPR017930Myb domain
SuperFamilySSF466894.03E-3011108IPR009057Homeodomain-like
SMARTSM007177.6E-121363IPR001005SANT/Myb domain
PfamPF002497.6E-151461IPR001005SANT/Myb domain
CDDcd001677.70E-111661No hitNo description
PROSITE profilePS5129425.72262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2665116IPR009057Homeodomain-like
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
PfamPF002497.0E-1467111IPR001005SANT/Myb domain
CDDcd001673.58E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRSPCCEKN GLKKGPWTSE EDEKLMDYIR DHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LKPDIKRGRF SSEEEEVIIQ LHSVLGNKWS AIATRLSGRT DNEIKNYWNT HIRKKLLRMG  120
IDPVTHSPRL DLLDLSSILS SSFSSSSHLM NFSGMVDGVV QPLINPEILR LAASLFSTSR  180
GAAQPENQNL ISSNQSWVQP VGHQLHQELT TTTTTSANMQ CGQFSAVDAQ SVVPTDWQSN  240
YTDGYDLHNG VQQPGHYNYG SSVAPSTEFG VPPSSVLSTP SSSPTPLNSN STYNNWNSST  300
EDERDSYCSD VFRFEIPDGI LDVSNFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211464.11e-126hypothetical protein PRUPE_ppa007438mg
TrEMBLM5WTM31e-126M5WTM3_PRUPE; Uncharacterized protein
STRINGGLYMA15G07230.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-97MYB-like 102